(data stored in SCRATCH3701 zone)

EMBL: CP000435.RPSM

CP000435.RPSM        Location/Qualifiers
FT   CDS             complement(424487..424852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="sync_0416"
FT                   /product="ribosomal protein S13"
FT                   /note="identified by match to protein family HMM PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46073"
FT                   /db_xref="GOA:Q0ID26"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0ID26"
FT                   /protein_id="ABI46073.1"
FT                   /translation="MARIAGVDIPRDKRIEVALTYIYGIGSTRAKTILTKAGVNPDIRV
FT                   KDLEDNDVQKLRNATESFTIEGDLRRQEGMALKRLQDIGCLRGRRHRMSLPVRGQRTRT
FT                   NARTRRGARKTVAGKKK"
     MARIAGVDIP RDKRIEVALT YIYGIGSTRA KTILTKAGVN PDIRVKDLED NDVQKLRNAT        60
     ESFTIEGDLR RQEGMALKRL QDIGCLRGRR HRMSLPVRGQ RTRTNARTRR GARKTVAGKK       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page