(data stored in SCRATCH3701 zone)

EMBL: CP000435.TKT

CP000435.TKT         Location/Qualifiers
FT   CDS             complement(136863..138872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt"
FT                   /locus_tag="sync_0130"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="identified by match to protein family HMM PF00456;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM PF02780; match to protein family HMM TIGR00232"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45379"
FT                   /db_xref="GOA:Q0IDV5"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDV5"
FT                   /protein_id="ABI45379.1"
FT                   /translation="MAAATASLDTLCVNSIRMLAVDAVNKSNSGHPGLPMGCAPMGYTL
FT                   WDKFLKHNPKNPKWFNRDRFVLSAGHGCMLQYALLHLTGYDSVTIDDIKQFRQWGSKTP
FT                   GHPETFETPGIEVTTGPLGAGISNAVGLAIAESHLGAKFNKADAKVVDHFTYVIMGDGC
FT                   NQEGVASEAASLAGHLKLGKLIALYDDNHITIDGRTDVSFTEDVLKRYEAYGWHVQHVA
FT                   DGDTDVNAIAKAIEAAKAVTNKPSIIKVTTTIGYGSPNKSDTAGVHGAPLGAEEAELTR
FT                   KQLGWTHGPFEIPQEAYDQYRQAVERGASQEAEWNQSLANYRSKYPTESAEFERMLRGE
FT                   LPQGWDKDLPTYTPDDKGLATRKHSQICLGALGANLPELIGGSADLTHSNYTDIAGETG
FT                   SYQPETPEKRYLHFGVREHAMAAVLNGIAYHNSGLIPYGGTFLVFADYMRGSMRLSALS
FT                   MLGVIYVLTHDSIGVGEDGPTHQPIETIPSLRAMPGMLVFRPGDGNETSGAYKLAIENR
FT                   NRPSAMCLSRQGMANQANSSIDKVAFGGYILEDCAGTPDLILIGTGTELDLCVQAAKQL
FT                   TSEGKNVRVVSMPCVELYDEQSDAYKEEVLPNAVRKRIVVEAAETFGWHRFIGLDGDSI
FT                   TMNRFGASAPGGTCMEKFGFTVDNVVAKSKALLG"
     MAAATASLDT LCVNSIRMLA VDAVNKSNSG HPGLPMGCAP MGYTLWDKFL KHNPKNPKWF        60
     NRDRFVLSAG HGCMLQYALL HLTGYDSVTI DDIKQFRQWG SKTPGHPETF ETPGIEVTTG       120
     PLGAGISNAV GLAIAESHLG AKFNKADAKV VDHFTYVIMG DGCNQEGVAS EAASLAGHLK       180
     LGKLIALYDD NHITIDGRTD VSFTEDVLKR YEAYGWHVQH VADGDTDVNA IAKAIEAAKA       240
     VTNKPSIIKV TTTIGYGSPN KSDTAGVHGA PLGAEEAELT RKQLGWTHGP FEIPQEAYDQ       300
     YRQAVERGAS QEAEWNQSLA NYRSKYPTES AEFERMLRGE LPQGWDKDLP TYTPDDKGLA       360
     TRKHSQICLG ALGANLPELI GGSADLTHSN YTDIAGETGS YQPETPEKRY LHFGVREHAM       420
     AAVLNGIAYH NSGLIPYGGT FLVFADYMRG SMRLSALSML GVIYVLTHDS IGVGEDGPTH       480
     QPIETIPSLR AMPGMLVFRP GDGNETSGAY KLAIENRNRP SAMCLSRQGM ANQANSSIDK       540
     VAFGGYILED CAGTPDLILI GTGTELDLCV QAAKQLTSEG KNVRVVSMPC VELYDEQSDA       600
     YKEEVLPNAV RKRIVVEAAE TFGWHRFIGL DGDSITMNRF GASAPGGTCM EKFGFTVDNV       660
     VAKSKALLG                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page