(data stored in SCRATCH3701 zone)

EMBL: CP000435.TYRA

CP000435.TYRA        Location/Qualifiers
FT   CDS             443913..444791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="sync_0447"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="identified by match to protein family HMM PF02153;
FT                   match to protein family HMM PF02558; match to protein
FT                   family HMM PF02737; match to protein family HMM PF03807"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45874"
FT                   /db_xref="GOA:Q0ICZ6"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICZ6"
FT                   /protein_id="ABI45874.1"
FT                   /translation="MDQGQVAQPWSIDRVGVVGMGLIGGSIALDLTQQGVEVHGLVHRE
FT                   VTAQRARSRGLASLISTDPSCLHDCDLVILALPLESLLSPAESLLKALPEQAVVTDVGS
FT                   VKAEVLAVWRDLHPRFVGSHPMAGTAQAGVDAGLTGLFRDRPWVATPESSTDPSALEVI
FT                   HQLAVRLGSHWLTADAARHDQAVALISHLPVIVSAALLRAVGEERDPAVLDLARTLASS
FT                   GFADTSRVGGGNPALGTAMASRNTQAVLRSLAAYRWSLEQLEEAILEGHWAQLEKELER
FT                   TQLLRPQFLSD"
     MDQGQVAQPW SIDRVGVVGM GLIGGSIALD LTQQGVEVHG LVHREVTAQR ARSRGLASLI        60
     STDPSCLHDC DLVILALPLE SLLSPAESLL KALPEQAVVT DVGSVKAEVL AVWRDLHPRF       120
     VGSHPMAGTA QAGVDAGLTG LFRDRPWVAT PESSTDPSAL EVIHQLAVRL GSHWLTADAA       180
     RHDQAVALIS HLPVIVSAAL LRAVGEERDP AVLDLARTLA SSGFADTSRV GGGNPALGTA       240
     MASRNTQAVL RSLAAYRWSL EQLEEAILEG HWAQLEKELE RTQLLRPQFL SD               292
//

If you have problems or comments...

PBIL Back to PBIL home page