(data stored in SCRATCH3701 zone)

EMBL: CP000435.WECD

CP000435.WECD        Location/Qualifiers
FT   CDS             complement(88284..88739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecD"
FT                   /locus_tag="sync_0084"
FT                   /product="unnamed protein product"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45302"
FT                   /db_xref="GOA:Q0IE01"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE01"
FT                   /protein_id="ABI45302.1"
FT                   /translation="MARIRLVQHAAGAPGLRWFGLGPDLKPSRSLLKLRRLLHKHAFWA
FT                   QQRNTADLKRMLAGSRVVVSLWRGKRMVGFGRATSDGIHRAVLWDVVVAGDLQGRGLGR
FT                   RVVEALLSAKAIRNAERVYLMTTNSSGFYQQLGFEPASTQQLLIRKQ"
     MARIRLVQHA AGAPGLRWFG LGPDLKPSRS LLKLRRLLHK HAFWAQQRNT ADLKRMLAGS        60
     RVVVSLWRGK RMVGFGRATS DGIHRAVLWD VVVAGDLQGR GLGRRVVEAL LSAKAIRNAE       120
     RVYLMTTNSS GFYQQLGFEP ASTQQLLIRK Q                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page