(data stored in ACNUC7421 zone)

EMBL: CP000438.ACCC

CP000438.ACCC        Location/Qualifiers
FT   CDS             565793..567169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="PA14_06450"
FT                   /product="putative acyl-CoA carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06450"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15459"
FT                   /db_xref="GOA:A0A0H2ZL34"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL34"
FT                   /protein_id="ABJ15459.1"
FT                   /translation="MHKRLNKLLVANRGEIAVRIIRAAQALGIPTVAVCSEADRDSLAA
FT                   RLADEVRLIGPARAERSYLDIEAILMAARETGADSIHPGYGFLSENPAFAEAVQAAGLV
FT                   FVGPDAQTIRRMGDKAEARRTAMAAGVPVVPGSPGELDDLDAALACAEEVGYPLLVKAS
FT                   AGGGGRGIRIAHDADELRREFPIAQREAQAAFGSPAVYLERFIRQARHIEVQILGDGER
FT                   AVHLFERECSLQRRRQKVFEEAPSAALDGAQRQALCESAVRLAQSLGYRGAGTLEYLFD
FT                   AHSGEFFFIEMNTRIQVEHPVSEMVTGIDLVQAMLRIAAGEALPWRQEDIRLNGAALEM
FT                   RINAEDPARNFFPSPGTVERLEWPQGEGVRVDSHLYPGYRVPPYYDSLLAKLIVHGRDR
FT                   DEAFARARQALERTVLAGMATTLPLHRWLLADARVQAAQFDTATLETWLAERTAAAQEV
FT                   "
     MHKRLNKLLV ANRGEIAVRI IRAAQALGIP TVAVCSEADR DSLAARLADE VRLIGPARAE        60
     RSYLDIEAIL MAARETGADS IHPGYGFLSE NPAFAEAVQA AGLVFVGPDA QTIRRMGDKA       120
     EARRTAMAAG VPVVPGSPGE LDDLDAALAC AEEVGYPLLV KASAGGGGRG IRIAHDADEL       180
     RREFPIAQRE AQAAFGSPAV YLERFIRQAR HIEVQILGDG ERAVHLFERE CSLQRRRQKV       240
     FEEAPSAALD GAQRQALCES AVRLAQSLGY RGAGTLEYLF DAHSGEFFFI EMNTRIQVEH       300
     PVSEMVTGID LVQAMLRIAA GEALPWRQED IRLNGAALEM RINAEDPARN FFPSPGTVER       360
     LEWPQGEGVR VDSHLYPGYR VPPYYDSLLA KLIVHGRDRD EAFARARQAL ERTVLAGMAT       420
     TLPLHRWLLA DARVQAAQFD TATLETWLAE RTAAAQEV                               458
//

If you have problems or comments...

PBIL Back to PBIL home page