(data stored in ACNUC7421 zone)

EMBL: CP000438.AHPC

CP000438.AHPC        Location/Qualifiers
FT   CDS             156164..156727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="PA14_01710"
FT                   /product="alkyl hydroperoxide reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15095"
FT                   /db_xref="GOA:Q02UU0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UU0"
FT                   /protein_id="ABJ15095.1"
FT                   /translation="MSLINTQVQPFKVNAFHNGKFIEVTEESLKGKWSVLIFMPAAFTF
FT                   NCPTEIEDAANNYGEFQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLIGDPTHQL
FT                   TNAFGVHIPEEGLALRGTFVINPEGVIKTVEIHSNEIARDVGETVRKLKAAQYTAAHPG
FT                   EVCPAKWKEGEKTLAPSLDLVGKI"
     MSLINTQVQP FKVNAFHNGK FIEVTEESLK GKWSVLIFMP AAFTFNCPTE IEDAANNYGE        60
     FQKAGAEVYI VTTDTHFSHK VWHETSPAVG KAQFPLIGDP THQLTNAFGV HIPEEGLALR       120
     GTFVINPEGV IKTVEIHSNE IARDVGETVR KLKAAQYTAA HPGEVCPAKW KEGEKTLAPS       180
     LDLVGKI                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page