(data stored in ACNUC7421 zone)

EMBL: CP000438.AHPF

CP000438.AHPF        Location/Qualifiers
FT   CDS             156872..158437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="PA14_01720"
FT                   /product="alkyl hydroperoxide reductase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01720"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15096"
FT                   /db_xref="GOA:A0A0H2ZK64"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK64"
FT                   /protein_id="ABJ15096.1"
FT                   /translation="MLDANLKTQLKAYLEKVSQPFEIVASLDDSDKSRELLGLLQDIVG
FT                   LTDKITLKTDGSDARKPSFSLNRPGADIGLRFAGIPMGHEFTSLVLALLQVGGHPSKLD
FT                   ADVIEQVKGIEGTFEFETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVE
FT                   ARQIMSVPSIYLNGEVFGQGRMGVEEILAKIDTGAAARDAEKLTARDAFDVLVVGGGPA
FT                   GAAAAIYAARKGIRTGVAAERFGGQVLDTMAIENFISVQETDGPKLARALEEHVRHYEV
FT                   DIMNLQRASKLVPAKNTGELHEVQFESGGSLKAKTLILATGARWREMGVPGEQEYKAKG
FT                   VCFCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFDSKLRADAVLQRKL
FT                   YSLPNVEVITSALTSEVKGDGQKVTGLVYKDRNSEEFKSIELEGIFVQIGLLPNTEWLK
FT                   GSVELSPRGEIIVDARGETSLPGIFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRT
FT                   SAPE"
     MLDANLKTQL KAYLEKVSQP FEIVASLDDS DKSRELLGLL QDIVGLTDKI TLKTDGSDAR        60
     KPSFSLNRPG ADIGLRFAGI PMGHEFTSLV LALLQVGGHP SKLDADVIEQ VKGIEGTFEF       120
     ETYFSLSCQN CPDVVQALNL MAVLNPNIRH VAIDGALFQD EVEARQIMSV PSIYLNGEVF       180
     GQGRMGVEEI LAKIDTGAAA RDAEKLTARD AFDVLVVGGG PAGAAAAIYA ARKGIRTGVA       240
     AERFGGQVLD TMAIENFISV QETDGPKLAR ALEEHVRHYE VDIMNLQRAS KLVPAKNTGE       300
     LHEVQFESGG SLKAKTLILA TGARWREMGV PGEQEYKAKG VCFCPHCDGP LFKGKRVAVI       360
     GGGNSGVEAA IDLAGIVAHV TLLEFDSKLR ADAVLQRKLY SLPNVEVITS ALTSEVKGDG       420
     QKVTGLVYKD RNSEEFKSIE LEGIFVQIGL LPNTEWLKGS VELSPRGEII VDARGETSLP       480
     GIFAAGDVTT VPYKQIVIAV GEGAKASLSA FDHLIRTSAP E                           521
//

If you have problems or comments...

PBIL Back to PBIL home page