(data stored in ACNUC7421 zone)

EMBL: CP000438.APAG

CP000438.APAG        Location/Qualifiers
FT   CDS             complement(662979..663359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="PA14_07710"
FT                   /product="putative apaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15555"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TH2"
FT                   /protein_id="ABJ15555.1"
FT                   /translation="MSDTQHQVNVRVDTRYLPEQSAPEQNRFAFAYTVTIENQGEVPAQ
FT                   LLSRHWIITDGDGRTQEVRGAGVVGEQPLIAPGAQHTYTSGTVLATRVGSMRGSYQMLG
FT                   SDGIAFDAAIPVFRLAVPGALH"
     MSDTQHQVNV RVDTRYLPEQ SAPEQNRFAF AYTVTIENQG EVPAQLLSRH WIITDGDGRT        60
     QEVRGAGVVG EQPLIAPGAQ HTYTSGTVLA TRVGSMRGSY QMLGSDGIAF DAAIPVFRLA       120
     VPGALH                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page