(data stored in ACNUC7421 zone)

EMBL: CP000438.ATSR

CP000438.ATSR        Location/Qualifiers
FT   CDS             211201..212262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atsR"
FT                   /locus_tag="PA14_02360"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15143"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA9"
FT                   /protein_id="ABJ15143.1"
FT                   /translation="MKALTSSLLGLFAAPVLAGLLGAYVPLASAAPPKEIRIAVPDVSA
FT                   GSSHSGGGVVDVLYTRQLLEKEFANDGIAVKWSFFKGAGPVVNEAFANGQVDFAYLGDL
FT                   AAIIGKSGGLDSRLLAATARGVNHYLGVQPGSGIKTLEDLKGKRVGIFRGTASQLSFDN
FT                   ALASVGLSEKDLKVINLDFSAALSALAARQIDATWGLAGLFALRDRGLAEIPLSTRDLN
FT                   GAGTLQALLVGSGAFVDAHPDITERLLKVQLQAQDWLAREENRDAYIELVSKQASYPVV
FT                   ILQSEYRGRKLGDALSPRLDADFLGRLDASIQAAKRFGLIRREFSAEQWAAPELLEAAG
FT                   KLAKAKAVAQAAE"
     MKALTSSLLG LFAAPVLAGL LGAYVPLASA APPKEIRIAV PDVSAGSSHS GGGVVDVLYT        60
     RQLLEKEFAN DGIAVKWSFF KGAGPVVNEA FANGQVDFAY LGDLAAIIGK SGGLDSRLLA       120
     ATARGVNHYL GVQPGSGIKT LEDLKGKRVG IFRGTASQLS FDNALASVGL SEKDLKVINL       180
     DFSAALSALA ARQIDATWGL AGLFALRDRG LAEIPLSTRD LNGAGTLQAL LVGSGAFVDA       240
     HPDITERLLK VQLQAQDWLA REENRDAYIE LVSKQASYPV VILQSEYRGR KLGDALSPRL       300
     DADFLGRLDA SIQAAKRFGL IRREFSAEQW AAPELLEAAG KLAKAKAVAQ AAE              353
//

If you have problems or comments...

PBIL Back to PBIL home page