(data stored in ACNUC7421 zone)

EMBL: CP000438.BFRG

CP000438.BFRG        Location/Qualifiers
FT   CDS             499715..501907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfrG"
FT                   /locus_tag="PA14_05640"
FT                   /product="putative outer membrane ferric siderophore
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05640"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15401"
FT                   /db_xref="GOA:A0A0H2ZK72"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK72"
FT                   /protein_id="ABJ15401.1"
FT                   /translation="MKKHSTARRVLALGLNLTLAGVPAWLWADEEPTELPALTVSAGAA
FT                   GETPPALDLDDSAGGGSRLGLSLRETPGSVSVANRASFERRGLRSTQDIANSLPGVNAS
FT                   APPGFGGFVTYRGFSSNQVNQLFNGIPVQYSSAMRPLDDWIVDRVELVGGPSSFLNGAG
FT                   AVGGSLDYISKLADRYGDFMEGRVRYGSYDDSEVAFGFNQALGIGPEPKHFVRLDVSRS
FT                   GGNGYVDRNSRESWNVAFSLLSDLTPDLSHTLALEYQDEQEDSPYWGTPVLNPYAGELK
FT                   IDKSRRRENYNVADGRYEQRVRWLRSILEYRVSDSTRWRNTFYHYDAERDYRNLETYRY
FT                   NADNSGVVRSNAFLQRHDQQLNGNRFELQHSQPLFGLASDWALGFDYSINKQTRFPSTA
FT                   SGPFGTVDPASFEPGHFYDLPGMRPGHRKDRSNEVRTSALFAENRLGLTDELSLVTGLR
FT                   YDHLDLDVRNHRTVTASDPAHFERRWDVLTGRAGLVYQFTPHANVYLQYSTAADPPGGV
FT                   LTSASFGQVRDYDLSTGDQWELGSKFDFLDGRGSATLAAYRIVRRDFSVADPNNPNLSV
FT                   PVGQQTSRGIEAAASLRITPKLLAEGNFAWVDAQYDEFTENVGGVAVSRKGKTPPNVPE
FT                   RVGNLWLTYDFDPAWQGGVDARYVSSVYANNANTWHVPSYTVYGTFLSYRLDERTRITG
FT                   RVRNLTDEVYARFVQSTPLYYVGDPRTFELSVQTRF"
     MKKHSTARRV LALGLNLTLA GVPAWLWADE EPTELPALTV SAGAAGETPP ALDLDDSAGG        60
     GSRLGLSLRE TPGSVSVANR ASFERRGLRS TQDIANSLPG VNASAPPGFG GFVTYRGFSS       120
     NQVNQLFNGI PVQYSSAMRP LDDWIVDRVE LVGGPSSFLN GAGAVGGSLD YISKLADRYG       180
     DFMEGRVRYG SYDDSEVAFG FNQALGIGPE PKHFVRLDVS RSGGNGYVDR NSRESWNVAF       240
     SLLSDLTPDL SHTLALEYQD EQEDSPYWGT PVLNPYAGEL KIDKSRRREN YNVADGRYEQ       300
     RVRWLRSILE YRVSDSTRWR NTFYHYDAER DYRNLETYRY NADNSGVVRS NAFLQRHDQQ       360
     LNGNRFELQH SQPLFGLASD WALGFDYSIN KQTRFPSTAS GPFGTVDPAS FEPGHFYDLP       420
     GMRPGHRKDR SNEVRTSALF AENRLGLTDE LSLVTGLRYD HLDLDVRNHR TVTASDPAHF       480
     ERRWDVLTGR AGLVYQFTPH ANVYLQYSTA ADPPGGVLTS ASFGQVRDYD LSTGDQWELG       540
     SKFDFLDGRG SATLAAYRIV RRDFSVADPN NPNLSVPVGQ QTSRGIEAAA SLRITPKLLA       600
     EGNFAWVDAQ YDEFTENVGG VAVSRKGKTP PNVPERVGNL WLTYDFDPAW QGGVDARYVS       660
     SVYANNANTW HVPSYTVYGT FLSYRLDERT RITGRVRNLT DEVYARFVQS TPLYYVGDPR       720
     TFELSVQTRF                                                              730
//

If you have problems or comments...

PBIL Back to PBIL home page