(data stored in ACNUC7421 zone)

EMBL: CP000438.BIOC

CP000438.BIOC        Location/Qualifiers
FT   CDS             572694..573518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioC"
FT                   /locus_tag="PA14_06540"
FT                   /product="putative biotin synthesis protein BioC"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06540"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15465"
FT                   /db_xref="GOA:A0A0H2ZLC0"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLC0"
FT                   /protein_id="ABJ15465.1"
FT                   /translation="MPDDSAPLLAPHGVAALPDKRRVAASFSRAAASYDAVAELQRGVG
FT                   ESLLSALPEGFSPRRWVDLGCGTGHFSRALERRFGAAEGLAVDIAEGMLRHARARGGAS
FT                   HFIGGDAERLPLRDGSCDLLFSSLAIQWCADLPAVLAEARRVLRPGGVLAFSSLCVGTL
FT                   GELRDSWRVVDGFVHVNRFRAFADYLQHAAGSGLLPLTLRHEDRVLHFPDLRSLTHELK
FT                   ALGAHNLNPGRPDGLTGRQRIRALVAAYERFRQPEGLPATYRVVFGVLRKDS"
     MPDDSAPLLA PHGVAALPDK RRVAASFSRA AASYDAVAEL QRGVGESLLS ALPEGFSPRR        60
     WVDLGCGTGH FSRALERRFG AAEGLAVDIA EGMLRHARAR GGASHFIGGD AERLPLRDGS       120
     CDLLFSSLAI QWCADLPAVL AEARRVLRPG GVLAFSSLCV GTLGELRDSW RVVDGFVHVN       180
     RFRAFADYLQ HAAGSGLLPL TLRHEDRVLH FPDLRSLTHE LKALGAHNLN PGRPDGLTGR       240
     QRIRALVAAY ERFRQPEGLP ATYRVVFGVL RKDS                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page