(data stored in ACNUC7421 zone)

EMBL: CP000438.BIOH

CP000438.BIOH        Location/Qualifiers
FT   CDS             571979..572701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="PA14_06530"
FT                   /product="putative biotin biosynthesis protein bioH"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15464"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD0"
FT                   /protein_id="ABJ15464.1"
FT                   /translation="MRDHLILLPGWGLGSAPLEPLRDALHEREPHLNVLIEPLPSLDDA
FT                   ADWLDELDDNLPRDSWLAGWSLGGMLAGELAARRGDDCRGLLTLASNPCFRVREDWPNA
FT                   MPAETFEDFFEAFLLEPHLTRKRFTLLVSQGARDPRTLARQLQVALPQLEREALVAGLQ
FT                   LLGQLDTRAALENFRGPQLHLFAEADALVPVAAAEALLEWLPDVEVSTLAASHGLPLEC
FT                   PDEVASAILRFLREGDDA"
     MRDHLILLPG WGLGSAPLEP LRDALHEREP HLNVLIEPLP SLDDAADWLD ELDDNLPRDS        60
     WLAGWSLGGM LAGELAARRG DDCRGLLTLA SNPCFRVRED WPNAMPAETF EDFFEAFLLE       120
     PHLTRKRFTL LVSQGARDPR TLARQLQVAL PQLEREALVA GLQLLGQLDT RAALENFRGP       180
     QLHLFAEADA LVPVAAAEAL LEWLPDVEVS TLAASHGLPL ECPDEVASAI LRFLREGDDA       240
//

If you have problems or comments...

PBIL Back to PBIL home page