(data stored in ACNUC7421 zone)

EMBL: CP000438.CATI

CP000438.CATI        Location/Qualifiers
FT   CDS             245632..246483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catI"
FT                   /locus_tag="PA14_02760"
FT                   /product="putative CoA transferase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02760"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15175"
FT                   /db_xref="GOA:A0A0H2ZKE2"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE2"
FT                   /protein_id="ABJ15175.1"
FT                   /translation="MAEILSLREAVRRFVHDGDSVALEGFTHLIPTAAGHELIRQGRKD
FT                   LTLIRMTPDLVYDLLIGAGCAKKLVFSWGGNPGVGSLHRLRDAVEKGWPHPLEIEEHSH
FT                   ADLANAYVAGASGLPFAVLRAYAGSDLPKVNPLIRSVTCPFTGEVLAAVPSVRPDVSVI
FT                   HAQKADRKGNVLLWGILGVQKEAALAAKRCIVTVEEIVDELDAPMNACVLPSWALSAVC
FT                   LVPGGAHPSYAHGYYERDNRFYQDWDPIARDRESFTAWIDEYIRGTEDFGAFQAKLAEG
FT                   KR"
     MAEILSLREA VRRFVHDGDS VALEGFTHLI PTAAGHELIR QGRKDLTLIR MTPDLVYDLL        60
     IGAGCAKKLV FSWGGNPGVG SLHRLRDAVE KGWPHPLEIE EHSHADLANA YVAGASGLPF       120
     AVLRAYAGSD LPKVNPLIRS VTCPFTGEVL AAVPSVRPDV SVIHAQKADR KGNVLLWGIL       180
     GVQKEAALAA KRCIVTVEEI VDELDAPMNA CVLPSWALSA VCLVPGGAHP SYAHGYYERD       240
     NRFYQDWDPI ARDRESFTAW IDEYIRGTED FGAFQAKLAE GKR                         283
//

If you have problems or comments...

PBIL Back to PBIL home page