(data stored in ACNUC7421 zone)

EMBL: CP000438.CHED

CP000438.CHED        Location/Qualifiers
FT   CDS             complement(196940..197542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="PA14_02190"
FT                   /product="putative chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15131"
FT                   /db_xref="GOA:A0A0H2ZJB1"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJB1"
FT                   /protein_id="ABJ15131.1"
FT                   /translation="MNLQAREGAPLNRYYDPYFACDAVKLLPGEYFASGEDLVIVTVLG
FT                   SCVSVCLRDPLNGIAGMNHFMLPERGLGGDPASPSARYGSHAMELLINRMLALGANRER
FT                   LQAKVFGGGSVLRQISAAIGQRNVEFTLDYLATERIPLLASDVLEAFPRKIYFFPRNGR
FT                   VLVKSLVELKNDTVLQRERDYRRRIDRNADGGPIDLF"
     MNLQAREGAP LNRYYDPYFA CDAVKLLPGE YFASGEDLVI VTVLGSCVSV CLRDPLNGIA        60
     GMNHFMLPER GLGGDPASPS ARYGSHAMEL LINRMLALGA NRERLQAKVF GGGSVLRQIS       120
     AAIGQRNVEF TLDYLATERI PLLASDVLEA FPRKIYFFPR NGRVLVKSLV ELKNDTVLQR       180
     ERDYRRRIDR NADGGPIDLF                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page