(data stored in ACNUC7421 zone)

EMBL: CP000438.CHER

CP000438.CHER        Location/Qualifiers
FT   CDS             complement(197548..198390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="PA14_02200"
FT                   /product="putative chemotaxis protein methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15132"
FT                   /db_xref="GOA:A0A0H2ZKB0"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB0"
FT                   /protein_id="ABJ15132.1"
FT                   /translation="MPTSTPSPVFGNQEFHYTREDFQQVRERLYRLTGISLAESKAQLV
FT                   YSRLSRRLRLLRLGSFAEYFTHLDREPGEQQLFVNALTTNLTAFFRERHHFPLLADLAR
FT                   RQLQRHRPLRIWSAAASTGEEPYSIAITLVEALGSFDPPVKIVASDIDTGVLDCARLGV
FT                   YPLERLEQMPAPLKKRFFLRGTGPNAGKARVVEELRQLVEFRQINLLEADWSIAGELDA
FT                   IFCRNVMIYFDKPTQTRLLERMVALLRPEGLFFAGHSENFVHASHLVRPVGQTVYSPA"
     MPTSTPSPVF GNQEFHYTRE DFQQVRERLY RLTGISLAES KAQLVYSRLS RRLRLLRLGS        60
     FAEYFTHLDR EPGEQQLFVN ALTTNLTAFF RERHHFPLLA DLARRQLQRH RPLRIWSAAA       120
     STGEEPYSIA ITLVEALGSF DPPVKIVASD IDTGVLDCAR LGVYPLERLE QMPAPLKKRF       180
     FLRGTGPNAG KARVVEELRQ LVEFRQINLL EADWSIAGEL DAIFCRNVMI YFDKPTQTRL       240
     LERMVALLRP EGLFFAGHSE NFVHASHLVR PVGQTVYSPA                             280
//

If you have problems or comments...

PBIL Back to PBIL home page