(data stored in ACNUC7421 zone)

EMBL: CP000438.CHEW

CP000438.CHEW        Location/Qualifiers
FT   CDS             complement(200535..201020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="PA14_02230"
FT                   /product="putative purine-binding chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02230"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15134"
FT                   /db_xref="GOA:A0A0H2ZKI9"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI9"
FT                   /protein_id="ABJ15134.1"
FT                   /translation="MNGTEASQANGPAQEYLTFTLGREEYAIDILRVQEIRGYDQVTAI
FT                   ANAPPFIKGVINLRGAIVPIVDLRIKFHLAEVTYDPFTVVIILNIGRRIVGVVVDSVSD
FT                   VIALGGDAIRPPPEFGASFDTEYLLGLATAGERMLILVDIERLMTSREMALVDEAAA"
     MNGTEASQAN GPAQEYLTFT LGREEYAIDI LRVQEIRGYD QVTAIANAPP FIKGVINLRG        60
     AIVPIVDLRI KFHLAEVTYD PFTVVIILNI GRRIVGVVVD SVSDVIALGG DAIRPPPEFG       120
     ASFDTEYLLG LATAGERMLI LVDIERLMTS REMALVDEAA A                           161
//

If you have problems or comments...

PBIL Back to PBIL home page