(data stored in ACNUC7421 zone)

EMBL: CP000438.CHPC

CP000438.CHPC        Location/Qualifiers
FT   CDS             477315..477821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chpC"
FT                   /locus_tag="PA14_05410"
FT                   /product="putative chemotaxis protein methyltransferase
FT                   CheR"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15382"
FT                   /db_xref="GOA:A0A0H2ZLA3"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLA3"
FT                   /protein_id="ABJ15382.1"
FT                   /translation="MNQAVIEQDGMSRNTPANPTPDSLTGLLLPLSDRTLLLPNVAVAE
FT                   LIAYRNPQVAAGVPQWYLGQVAWRDLRLPLLSFEAASSGEQQPVLGSSARVVVINALGG
FT                   RPHVKFLALLVQGIPRSVRLDANLASTAAPLAALELAAVDIGGETARIPDLAGLEEKLA
FT                   DAGLI"
     MNQAVIEQDG MSRNTPANPT PDSLTGLLLP LSDRTLLLPN VAVAELIAYR NPQVAAGVPQ        60
     WYLGQVAWRD LRLPLLSFEA ASSGEQQPVL GSSARVVVIN ALGGRPHVKF LALLVQGIPR       120
     SVRLDANLAS TAAPLAALEL AAVDIGGETA RIPDLAGLEE KLADAGLI                    168
//

If you have problems or comments...

PBIL Back to PBIL home page