(data stored in ACNUC7421 zone)

EMBL: CP000438.CHPE

CP000438.CHPE        Location/Qualifiers
FT   CDS             478700..479311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chpE"
FT                   /locus_tag="PA14_05430"
FT                   /product="putative chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15384"
FT                   /db_xref="GOA:A0A0H2ZK58"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK58"
FT                   /protein_id="ABJ15384.1"
FT                   /translation="MLAIFLAALLFGFAFNVSPGAVFSETLRRGLTGGFRPALLVQLGS
FT                   LIGDAVWALLGLTGLALLLGYEQVRIPLTLACAAYLAWLGVQGLRDAWSPPLAAEDAGE
FT                   QGRNAFGAGAAISLSNPKNVVYWGALGSALAGIVDGTPNQAQSLVFFAGFMLSSLIWCF
FT                   CCAALVDWLRRNTSLFWHRVSYAGCGVLLLGLAGLALRGL"
     MLAIFLAALL FGFAFNVSPG AVFSETLRRG LTGGFRPALL VQLGSLIGDA VWALLGLTGL        60
     ALLLGYEQVR IPLTLACAAY LAWLGVQGLR DAWSPPLAAE DAGEQGRNAF GAGAAISLSN       120
     PKNVVYWGAL GSALAGIVDG TPNQAQSLVF FAGFMLSSLI WCFCCAALVD WLRRNTSLFW       180
     HRVSYAGCGV LLLGLAGLAL RGL                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page