(data stored in ACNUC7421 zone)

EMBL: CP000438.CLPA

CP000438.CLPA        Location/Qualifiers
FT   CDS             531095..533647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpA"
FT                   /locus_tag="PA14_06000"
FT                   /product="putative ClpA/B protease ATP binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06000"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15424"
FT                   /db_xref="GOA:A0A0H2ZLE4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLE4"
FT                   /protein_id="ABJ15424.1"
FT                   /translation="MDIAEYFSKQTTEYLQRAAQVAAEFGKREVDTEHLLYALADADVV
FT                   QAVLKQFGLSPADLKQYIEANAVRGASKGEASEDMTISPRVKSALQHAFALSRELGHSY
FT                   VGPEHLLLGLAAVPDSFAGTLLKKYGLTEQALRQKAVKVVGKGAEDGRVDGPSNTPQLD
FT                   KFSRDLTRLAREGKLDPVIGRSKEVETTIEVLARRKKNNPVLIGEPGVGKTAIVEGLAQ
FT                   RMVQGEVPEVLRDKRLVELNINAMVAGAKYRGEFEERLKQVMDELQAAQSEIILFIDEV
FT                   HTIVGAGQGGGEGGLDVANVLKPAMARGEMNLIGATTLNEYQKYIEKDAALERRFQPVF
FT                   VPEPTVEQTISILRGLRDKLEGHHKVTIRDEAFVAAAELSDRYIGNRFLPDKAIDLIDQ
FT                   AAARVRIASTSRPAEIQELEAELAQLKREQDYAASRKWYDEAKVFEKRIQERKEHLEQI
FT                   TERWQQTQGSKTEEVRVEDIAEIISKLTGIPVTELTAEEREKLLQMEERLHQRVIGQQE
FT                   AITAVSDAVRLARAGLRQGSRPIATFLFLGPTGVGKTELAKALAEVVFGDEDAMIRIDM
FT                   SEYMERHAVSRLIGAPPGYVGYDEGGQLTERVRRRPYSVILLDEIEKAHADVNNILLQV
FT                   FDDGRLTDGKGRVVDFTNTIIIATSNLGSELIMKNAQAGEFAQPPEKLKRELMTTLRGH
FT                   FRPEFLNRLDEVIVFESLSKAQIEDIVRLQLERVKRAAHAQDIYLHIDDSLVGHLAEEA
FT                   YQPEFGARELKRQIRQQLETRLATAMLKGEVKEGETVTFFYDAKDGVGYRKGAAPKPAA
FT                   RKKSGAGETPKGRATAARKPAAKKGAAAKGKADKPKTK"
     MDIAEYFSKQ TTEYLQRAAQ VAAEFGKREV DTEHLLYALA DADVVQAVLK QFGLSPADLK        60
     QYIEANAVRG ASKGEASEDM TISPRVKSAL QHAFALSREL GHSYVGPEHL LLGLAAVPDS       120
     FAGTLLKKYG LTEQALRQKA VKVVGKGAED GRVDGPSNTP QLDKFSRDLT RLAREGKLDP       180
     VIGRSKEVET TIEVLARRKK NNPVLIGEPG VGKTAIVEGL AQRMVQGEVP EVLRDKRLVE       240
     LNINAMVAGA KYRGEFEERL KQVMDELQAA QSEIILFIDE VHTIVGAGQG GGEGGLDVAN       300
     VLKPAMARGE MNLIGATTLN EYQKYIEKDA ALERRFQPVF VPEPTVEQTI SILRGLRDKL       360
     EGHHKVTIRD EAFVAAAELS DRYIGNRFLP DKAIDLIDQA AARVRIASTS RPAEIQELEA       420
     ELAQLKREQD YAASRKWYDE AKVFEKRIQE RKEHLEQITE RWQQTQGSKT EEVRVEDIAE       480
     IISKLTGIPV TELTAEEREK LLQMEERLHQ RVIGQQEAIT AVSDAVRLAR AGLRQGSRPI       540
     ATFLFLGPTG VGKTELAKAL AEVVFGDEDA MIRIDMSEYM ERHAVSRLIG APPGYVGYDE       600
     GGQLTERVRR RPYSVILLDE IEKAHADVNN ILLQVFDDGR LTDGKGRVVD FTNTIIIATS       660
     NLGSELIMKN AQAGEFAQPP EKLKRELMTT LRGHFRPEFL NRLDEVIVFE SLSKAQIEDI       720
     VRLQLERVKR AAHAQDIYLH IDDSLVGHLA EEAYQPEFGA RELKRQIRQQ LETRLATAML       780
     KGEVKEGETV TFFYDAKDGV GYRKGAAPKP AARKKSGAGE TPKGRATAAR KPAAKKGAAA       840
     KGKADKPKTK                                                              850
//

If you have problems or comments...

PBIL Back to PBIL home page