(data stored in ACNUC7421 zone)

EMBL: CP000438.COIII

CP000438.COIII       Location/Qualifiers
FT   CDS             128595..129482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coIII"
FT                   /gene_synonym="cox3"
FT                   /gene_synonym="coxC"
FT                   /locus_tag="PA14_01320"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15065"
FT                   /db_xref="GOA:A0A0H2ZJT6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJT6"
FT                   /protein_id="ABJ15065.1"
FT                   /translation="MASHEHYYVPAQSKWPIIASIGLLVTVFGLGTWFNDLTAGHKESH
FT                   GPWIFFVGGLIIAYMLFGWFGNVIRESRAGLYSAQMDRSFRWGMSWFIFSEVMFFAAFF
FT                   GALFYVRHFAGPWLGGEGAKGVAHMLWPNFQYSWPLLQTPDPKLFPPPSAVIEPWKLPL
FT                   INTILLVTSSFTVTFAHHALKKNKRGPLKAWLALTVLLGIAFLILQAEEYVHAYNELGL
FT                   TLGAGIYGSTFFMLTGFHGAHVTLGALILSIMLIRILRGHFDAEHHFGFEAASWYWHFV
FT                   DVVWIGLFIFVYVI"
     MASHEHYYVP AQSKWPIIAS IGLLVTVFGL GTWFNDLTAG HKESHGPWIF FVGGLIIAYM        60
     LFGWFGNVIR ESRAGLYSAQ MDRSFRWGMS WFIFSEVMFF AAFFGALFYV RHFAGPWLGG       120
     EGAKGVAHML WPNFQYSWPL LQTPDPKLFP PPSAVIEPWK LPLINTILLV TSSFTVTFAH       180
     HALKKNKRGP LKAWLALTVL LGIAFLILQA EEYVHAYNEL GLTLGAGIYG STFFMLTGFH       240
     GAHVTLGALI LSIMLIRILR GHFDAEHHFG FEAASWYWHF VDVVWIGLFI FVYVI            295
//

If you have problems or comments...

PBIL Back to PBIL home page