(data stored in ACNUC7421 zone)

EMBL: CP000438.COXA

CP000438.COXA        Location/Qualifiers
FT   CDS             126427..128019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /gene_synonym="ctaD"
FT                   /locus_tag="PA14_01300"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15063"
FT                   /db_xref="GOA:A0A0H2ZK46"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK46"
FT                   /protein_id="ABJ15063.1"
FT                   /translation="MSAVIDTPDHHAGDHHHGPAKGLMRWVLTTNHKDIGTLYLWFSFM
FT                   MFLLGGSMAMVIRAELFQPGLQIVEPAFFNQMTTMHGLIMVFGAVMPAFVGLANWMIPL
FT                   MIGAPDMALPRMNNFSFWLLPAAFGLLVSTLFMPGGGPNFGWTFYAPLSTTFAPHSVTF
FT                   FIFAIHLAGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLAG
FT                   VVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSAIIPTFAR
FT                   KPLFGYTSMVYATASIAFLSFVVWAHHMFVVGIPVTGELFFMYATMLIAVPTGVKVFNW
FT                   VTTMWEGSLTFETPMLFAVAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAHFHYVLV
FT                   PGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWMSFIGMNLAFFPMHFVGLAGMPRRIP
FT                   DYNLQFADFNMVSSIGAFMFGTTQLLFLFIVIKCIRGGKPAPAKPWDGAEGLEWSIPSP
FT                   APYHTFSTPPEVK"
     MSAVIDTPDH HAGDHHHGPA KGLMRWVLTT NHKDIGTLYL WFSFMMFLLG GSMAMVIRAE        60
     LFQPGLQIVE PAFFNQMTTM HGLIMVFGAV MPAFVGLANW MIPLMIGAPD MALPRMNNFS       120
     FWLLPAAFGL LVSTLFMPGG GPNFGWTFYA PLSTTFAPHS VTFFIFAIHL AGISSIMGAI       180
     NVIATILNLR APGMTLMKMP LFVWTWLITA FLLIAVMPVL AGVVTMMLMD IHFGTSFFSA       240
     AGGGDPVLFQ HVFWFFGHPE VYIMILPAFG AVSAIIPTFA RKPLFGYTSM VYATASIAFL       300
     SFVVWAHHMF VVGIPVTGEL FFMYATMLIA VPTGVKVFNW VTTMWEGSLT FETPMLFAVA       360
     FVILFTIGGF SGLMLAIAPA DFQYHDTYFV VAHFHYVLVP GAIFGIFASA YYWLPKWTGH       420
     MYDETLGKLH FWMSFIGMNL AFFPMHFVGL AGMPRRIPDY NLQFADFNMV SSIGAFMFGT       480
     TQLLFLFIVI KCIRGGKPAP AKPWDGAEGL EWSIPSPAPY HTFSTPPEVK                  530
//

If you have problems or comments...

PBIL Back to PBIL home page