(data stored in ACNUC7421 zone)

EMBL: CP000438.COXB

CP000438.COXB        Location/Qualifiers
FT   CDS             125293..126417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxB"
FT                   /gene_synonym="coxII"
FT                   /gene_synonym="ctaC"
FT                   /locus_tag="PA14_01290"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15062"
FT                   /db_xref="GOA:A0A0H2ZK39"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK39"
FT                   /protein_id="ABJ15062.1"
FT                   /translation="MLRHPRVWMGFLLLSAISQANAAWTVNMAPGATEVSRSVFDLHMT
FT                   IFWICVVIGVLVFGAMFWSMIVHRRSTGQQPAHFHESTTVEILWTVVPFVILVVMAVPA
FT                   TRTLIHIYDTSEPELDVQVTGYQWKWQYKYLGQDVEYFSNLATPQDQIHNRQAKDEHYL
FT                   LEVDEPLVLPVGTKVRFLITSSDVIHSWWVPAFAVKRDAIPGFVNEAWTKVDEPGIYRG
FT                   QCAELCGKDHGFMPIVVDVKPKAEFDQWLAKRKEEAAKVKELTSKEWTKEELVARGDKV
FT                   YHTICAACHQAEGQGMPPMFPALKGSKIVTGPKEHHLEVVFNGVPGTAMAAFGKQLNEV
FT                   DLAAVITYERNAWGNDDGDMVTPKDVVAYKQKQQ"
     MLRHPRVWMG FLLLSAISQA NAAWTVNMAP GATEVSRSVF DLHMTIFWIC VVIGVLVFGA        60
     MFWSMIVHRR STGQQPAHFH ESTTVEILWT VVPFVILVVM AVPATRTLIH IYDTSEPELD       120
     VQVTGYQWKW QYKYLGQDVE YFSNLATPQD QIHNRQAKDE HYLLEVDEPL VLPVGTKVRF       180
     LITSSDVIHS WWVPAFAVKR DAIPGFVNEA WTKVDEPGIY RGQCAELCGK DHGFMPIVVD       240
     VKPKAEFDQW LAKRKEEAAK VKELTSKEWT KEELVARGDK VYHTICAACH QAEGQGMPPM       300
     FPALKGSKIV TGPKEHHLEV VFNGVPGTAM AAFGKQLNEV DLAAVITYER NAWGNDDGDM       360
     VTPKDVVAYK QKQQ                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page