(data stored in ACNUC7421 zone)

EMBL: CP000438.COXG

CP000438.COXG        Location/Qualifiers
FT   CDS             128030..128584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxG"
FT                   /locus_tag="PA14_01310"
FT                   /product="putative cytochrome c oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01310"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15064"
FT                   /db_xref="GOA:A0A0H2ZKB7"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKB7"
FT                   /protein_id="ABJ15064.1"
FT                   /translation="MSDAKVDTRRLVGRLLLVTVLMFAFGFALVPLYDVMCRALGINGK
FT                   TAGSAYSGEQQVDVGREVKVQFMTSNNIDMVWEFRSAGDQLVVHPGAVNQMVFYARNPS
FT                   DKPMTAQAIPSIAPAEAAAYFHKTECFCFTQQVLQPGESIEMPVRFIVDRDLPKDVRHV
FT                   TLAYTLFDITARKPPVPVAGR"
     MSDAKVDTRR LVGRLLLVTV LMFAFGFALV PLYDVMCRAL GINGKTAGSA YSGEQQVDVG        60
     REVKVQFMTS NNIDMVWEFR SAGDQLVVHP GAVNQMVFYA RNPSDKPMTA QAIPSIAPAE       120
     AAAYFHKTEC FCFTQQVLQP GESIEMPVRF IVDRDLPKDV RHVTLAYTLF DITARKPPVP       180
     VAGR                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page