(data stored in ACNUC7421 zone)

EMBL: CP000438.CREC

CP000438.CREC        Location/Qualifiers
FT   CDS             536757..538181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creC"
FT                   /gene_synonym="blrB"
FT                   /locus_tag="PA14_06070"
FT                   /product="two-component sensor CreC"
FT                   /note="catabolite repression sensor kinase for PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15429"
FT                   /db_xref="GOA:A0A0H2ZLE9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLE9"
FT                   /protein_id="ABJ15429.1"
FT                   /translation="MPLGVRIFLVYFLFVGLTGYFVLSTVMDEVRPGVRQSTEETLVDT
FT                   ANLLAEILRQDVKNGTLAQSDLPEMLEDYGKRVPQADIWGLRKEAVNHRIYVTDASGKV
FT                   LLDSAGVAVGQDYSRWNDVYLTLRGQYGARSSREDPDDPDSSVMYVAAPIKDAGKIIGV
FT                   VSVAKPNSSLQPYIDRSQRRLAWLGAGLIALGLLVGGLLSWWLSGALRRLTQYAQAVSE
FT                   GRRAELPRYRGGEMAQLADAVERMRTQLEGKDYVERYVHTLTHELKSPLAAIRGAAELL
FT                   DGEMPAEQRARFVGNIAGESERLQQLIERLLSLAQVEQRQGLEEVGKVDLREIAASLLE
FT                   GQAARIQRQRLRVENRLEGPCEVRGEQFLLRQALANLLDNALDFTPPGGILRLLAEADG
FT                   EGIALRLFNQGPAIPDYALARLTERFYSLPRPASGRKSTGLGLNFVAEVAQLHGGRLQV
FT                   GNRDDGVEALLWLPRG"
     MPLGVRIFLV YFLFVGLTGY FVLSTVMDEV RPGVRQSTEE TLVDTANLLA EILRQDVKNG        60
     TLAQSDLPEM LEDYGKRVPQ ADIWGLRKEA VNHRIYVTDA SGKVLLDSAG VAVGQDYSRW       120
     NDVYLTLRGQ YGARSSREDP DDPDSSVMYV AAPIKDAGKI IGVVSVAKPN SSLQPYIDRS       180
     QRRLAWLGAG LIALGLLVGG LLSWWLSGAL RRLTQYAQAV SEGRRAELPR YRGGEMAQLA       240
     DAVERMRTQL EGKDYVERYV HTLTHELKSP LAAIRGAAEL LDGEMPAEQR ARFVGNIAGE       300
     SERLQQLIER LLSLAQVEQR QGLEEVGKVD LREIAASLLE GQAARIQRQR LRVENRLEGP       360
     CEVRGEQFLL RQALANLLDN ALDFTPPGGI LRLLAEADGE GIALRLFNQG PAIPDYALAR       420
     LTERFYSLPR PASGRKSTGL GLNFVAEVAQ LHGGRLQVGN RDDGVEALLW LPRG             474
//

If you have problems or comments...

PBIL Back to PBIL home page