(data stored in ACNUC7421 zone)

EMBL: CP000438.CRED

CP000438.CRED        Location/Qualifiers
FT   CDS             538283..539641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="creD"
FT                   /gene_synonym="blrD"
FT                   /locus_tag="PA14_06080"
FT                   /product="inner membrane protein CreD"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06080"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15430"
FT                   /db_xref="GOA:A0A0H2ZKM3"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKM3"
FT                   /protein_id="ABJ15430.1"
FT                   /translation="MNRTLAYKLGAIALLILLLLIPLLMIDGLIRDRQEVRDGVLQDIA
FT                   RSSSYSQRLTGPLLVVPYRRTVREWVTEEKTEKRVLQEREQRGELYFLPDRFALDGQMR
FT                   TELRYRGIYQARLYHVDNKVAGYFQVPAHYGIEEDLEDYQFETPFLAMGISDIRGIENA
FT                   LRLSLNGASVDFEPGSRVGLLGSGVHAPLQGVDGRQAQRLEYAFDLSLLGSERLDIVPV
FT                   GRDSQVILKADWPHPSFGGEFLPSEREITAQGFTARWQTSFFATNMEEALRSCVEEQRC
FT                   DGFQARAFGVGLVDPVDQYLKADRAIKYALLFITLTFAGFFLFEVLKRLAVHPIQYALV
FT                   GLALAFFYLLLLSLAEHVGFELAYLVSAGACVGLIGFYLCFVLRSVARGLGFSAGLAGL
FT                   YGLLYGLLSAEDYALLMGSLLLFAVLAAVMVLTRRLDWYGVGRKDLPAVPDRA"
     MNRTLAYKLG AIALLILLLL IPLLMIDGLI RDRQEVRDGV LQDIARSSSY SQRLTGPLLV        60
     VPYRRTVREW VTEEKTEKRV LQEREQRGEL YFLPDRFALD GQMRTELRYR GIYQARLYHV       120
     DNKVAGYFQV PAHYGIEEDL EDYQFETPFL AMGISDIRGI ENALRLSLNG ASVDFEPGSR       180
     VGLLGSGVHA PLQGVDGRQA QRLEYAFDLS LLGSERLDIV PVGRDSQVIL KADWPHPSFG       240
     GEFLPSEREI TAQGFTARWQ TSFFATNMEE ALRSCVEEQR CDGFQARAFG VGLVDPVDQY       300
     LKADRAIKYA LLFITLTFAG FFLFEVLKRL AVHPIQYALV GLALAFFYLL LLSLAEHVGF       360
     ELAYLVSAGA CVGLIGFYLC FVLRSVARGL GFSAGLAGLY GLLYGLLSAE DYALLMGSLL       420
     LFAVLAAVMV LTRRLDWYGV GRKDLPAVPD RA                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page