(data stored in ACNUC7421 zone)

EMBL: CP000438.CTAA

CP000438.CTAA        Location/Qualifiers
FT   CDS             131135..132208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaA"
FT                   /locus_tag="PA14_01360"
FT                   /product="putative cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15069"
FT                   /db_xref="GOA:A0A0H2ZKC3"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC3"
FT                   /protein_id="ABJ15069.1"
FT                   /translation="MSGATRKPGFTVAVLATLLAAVVVLLGAYTRLTHAGLGCPDWPGC
FT                   YGFVHVPLSEAQLAHAELHFPDAPVEAQKGWNEMIHRYFAGALGLLILGLALHALVRRG
FT                   RDGQPLKLPLLLLAVVIAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLALLFLLALRLSG
FT                   RFAARRYPAATRGLAGLALFLVIGQIALGGWVSSNYAAVACIDLPTCHGEWWPRMDFAN
FT                   GFHLTQHIGPNYLGGQLDSDARTAIHMTHRIGALCVTLVLLLLAWRLQRSGLVWPTALM
FT                   LLGLSLQIGLGISNVLLHLPLPVAVAHNGGGALLLLSLVLVNYRLRAPASVRAPAPSPQ
FT                   RVRRTLPPAQGSRLKAA"
     MSGATRKPGF TVAVLATLLA AVVVLLGAYT RLTHAGLGCP DWPGCYGFVH VPLSEAQLAH        60
     AELHFPDAPV EAQKGWNEMI HRYFAGALGL LILGLALHAL VRRGRDGQPL KLPLLLLAVV       120
     IAQAAFGMWT VTLKLWPQVV TAHLLGGFTT LALLFLLALR LSGRFAARRY PAATRGLAGL       180
     ALFLVIGQIA LGGWVSSNYA AVACIDLPTC HGEWWPRMDF ANGFHLTQHI GPNYLGGQLD       240
     SDARTAIHMT HRIGALCVTL VLLLLAWRLQ RSGLVWPTAL MLLGLSLQIG LGISNVLLHL       300
     PLPVAVAHNG GGALLLLSLV LVNYRLRAPA SVRAPAPSPQ RVRRTLPPAQ GSRLKAA          357
//

If you have problems or comments...

PBIL Back to PBIL home page