(data stored in ACNUC7421 zone)

EMBL: CP000438.CYSA

CP000438.CYSA        Location/Qualifiers
FT   CDS             complement(328093..329082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="PA14_03650"
FT                   /product="sulfate transport protein CysA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03650"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15243"
FT                   /db_xref="GOA:A0A0H2ZJS9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS9"
FT                   /protein_id="ABJ15243.1"
FT                   /translation="MSIEIRNVSKNFNAFKALDDINLDIQSGELVALLGPSGCGKTTLL
FT                   RIIAGLETPDAGNIVFHGEDVSQHDVRDRNVGFVFQHYALFRHMTVFDNVAFGLRMKPK
FT                   GERPGESAIKAKVHELLNMVQLDWLADRYPEQLSGGQRQRIALARALAVEPKILLLDEP
FT                   FGALDAKVRKELRRWLARLHEEINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPG
FT                   EVYENPASDFVYHFLGDSNRLQLGNDQHLLFRPHEVSLSRSAVAEHRAAEVRDIRPLGA
FT                   ITRVTLKVDGQDELIEAEVVKDHDSLAGLARGETLYFKPKAFQPVANL"
     MSIEIRNVSK NFNAFKALDD INLDIQSGEL VALLGPSGCG KTTLLRIIAG LETPDAGNIV        60
     FHGEDVSQHD VRDRNVGFVF QHYALFRHMT VFDNVAFGLR MKPKGERPGE SAIKAKVHEL       120
     LNMVQLDWLA DRYPEQLSGG QRQRIALARA LAVEPKILLL DEPFGALDAK VRKELRRWLA       180
     RLHEEINLTS VFVTHDQEEA MEVADRIVVM NKGVIEQIGS PGEVYENPAS DFVYHFLGDS       240
     NRLQLGNDQH LLFRPHEVSL SRSAVAEHRA AEVRDIRPLG AITRVTLKVD GQDELIEAEV       300
     VKDHDSLAGL ARGETLYFKP KAFQPVANL                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page