(data stored in ACNUC7421 zone)

EMBL: CP000438.CYST

CP000438.CYST        Location/Qualifiers
FT   CDS             complement(329966..330784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="PA14_03680"
FT                   /product="sulfate transport protein CysT"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03680"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15245"
FT                   /db_xref="GOA:A0A0H2ZKL7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL7"
FT                   /protein_id="ABJ15245.1"
FT                   /translation="MSRRISPVIPGFGLTLGYTLVYLSLLVLIPLGAMFLKTTQLSWEQ
FT                   FWAIISAPRVLAALKLSFGTALAAAVLNGLIGTLLAWVLVRYEFPGRKIIDAMIDLPFA
FT                   LPTAVAGIALTALYAPAGLVGQFASDLGFKIAYTPLGITLALTFVTLPFVVRTVQPVLA
FT                   DIPKEVEEAAACLGARPLQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIAGNMP
FT                   MKTEILPLLIMVKLDQYDYTGATAIGVLMLVVSFILLLLINLLQRRIETP"
     MSRRISPVIP GFGLTLGYTL VYLSLLVLIP LGAMFLKTTQ LSWEQFWAII SAPRVLAALK        60
     LSFGTALAAA VLNGLIGTLL AWVLVRYEFP GRKIIDAMID LPFALPTAVA GIALTALYAP       120
     AGLVGQFASD LGFKIAYTPL GITLALTFVT LPFVVRTVQP VLADIPKEVE EAAACLGARP       180
     LQVFRHILVP ALLPAWLTGF ALAFARGVGE YGSVIFIAGN MPMKTEILPL LIMVKLDQYD       240
     YTGATAIGVL MLVVSFILLL LINLLQRRIE TP                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page