(data stored in ACNUC7421 zone)

EMBL: CP000438.CYSW

CP000438.CYSW        Location/Qualifiers
FT   CDS             complement(329086..329955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="PA14_03670"
FT                   /product="sulfate transport protein CysW"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03670"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15244"
FT                   /db_xref="GOA:A0A0H2ZKS1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKS1"
FT                   /protein_id="ABJ15244.1"
FT                   /translation="MSSASISAATASASRRGNAGGRLALIVLAWLVFALFLLLPLYVVL
FT                   SEALKQGFGTFFEAILEPDALAALKLTLIAVAISVPLNLLFGVAAAWCVSKFEFRGKSI
FT                   LVTLIDLPFSVSPVIAGLIYVLLFGAQGYFGEWLSDHDIQIVFAVPGIVLATLFVTVPF
FT                   VARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTLPNIKWGLIYGVVLCTARAMGEFG
FT                   AVSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFSVASLLLLMALVILLLKQWSESRMSR
FT                   LKSNADEE"
     MSSASISAAT ASASRRGNAG GRLALIVLAW LVFALFLLLP LYVVLSEALK QGFGTFFEAI        60
     LEPDALAALK LTLIAVAISV PLNLLFGVAA AWCVSKFEFR GKSILVTLID LPFSVSPVIA       120
     GLIYVLLFGA QGYFGEWLSD HDIQIVFAVP GIVLATLFVT VPFVARELIP LMQEQGTQEE       180
     EAARLLGANG WQMFWHVTLP NIKWGLIYGV VLCTARAMGE FGAVSVVSGH IRGVTNTLPL       240
     HVEILYNEYN HVAAFSVASL LLLMALVILL LKQWSESRMS RLKSNADEE                   289
//

If you have problems or comments...

PBIL Back to PBIL home page