(data stored in ACNUC7421 zone)

EMBL: CP000438.CZCD

CP000438.CZCD        Location/Qualifiers
FT   CDS             complement(453674..454573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcD"
FT                   /locus_tag="PA14_05200"
FT                   /product="putative cation efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15364"
FT                   /db_xref="GOA:A0A0H2ZKH9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH9"
FT                   /protein_id="ABJ15364.1"
FT                   /translation="MSAGHEHSFAQTNSTRLKWALLLTGSFLVAEVVGGILTGSLALIS
FT                   DAAHMLTDAVALAIALAAINIARRPTNDRLTYGYHRFEILAAAFNAFLLFGVAFYILYA
FT                   TYERLNQPAEIQSVGMLVIAVLGLLVNLASMRLLAPAQGNSLNVKGAYLEVWSDMLGSL
FT                   GVIVAAIVIRFTGWAWVDSLVAVLIGFWVLPRTWILLRESLHVLLEGVPKEIQLAELRE
FT                   ALLGIPGVTGLHDLHVWSITSGKISLTSHLVYDPALVDAEALLGTVKALLHDRYEIEHS
FT                   TLQLETSACAQAEEPLAY"
     MSAGHEHSFA QTNSTRLKWA LLLTGSFLVA EVVGGILTGS LALISDAAHM LTDAVALAIA        60
     LAAINIARRP TNDRLTYGYH RFEILAAAFN AFLLFGVAFY ILYATYERLN QPAEIQSVGM       120
     LVIAVLGLLV NLASMRLLAP AQGNSLNVKG AYLEVWSDML GSLGVIVAAI VIRFTGWAWV       180
     DSLVAVLIGF WVLPRTWILL RESLHVLLEG VPKEIQLAEL REALLGIPGV TGLHDLHVWS       240
     ITSGKISLTS HLVYDPALVD AEALLGTVKA LLHDRYEIEH STLQLETSAC AQAEEPLAY        299
//

If you have problems or comments...

PBIL Back to PBIL home page