(data stored in ACNUC7421 zone)

EMBL: CP000438.DEF

CP000438.DEF         Location/Qualifiers
FT   CDS             complement(21088..21594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="PA14_00200"
FT                   /product="polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14975"
FT                   /db_xref="GOA:A0A0H2ZK18"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK18"
FT                   /protein_id="ABJ14975.1"
FT                   /translation="MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGI
FT                   GLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEEMDQYQEGCLSVPGFYENVDR
FT                   PQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEKQ
FT                   HRQQA"
     MAILNILEFP DPRLRTIAKP VEVVDDAVRQ LIDDMFETMY EAPGIGLAAT QVNVHKRIVV        60
     MDLSEDKSEP RVFINPEFEP LTEEMDQYQE GCLSVPGFYE NVDRPQKVRI KALDRDGNPF       120
     EEVAEGLLAV CIQHECDHLN GKLFVDYLST LKRDRIRKKL EKQHRQQA                    168
//

If you have problems or comments...

PBIL Back to PBIL home page