(data stored in ACNUC7421 zone)

EMBL: CP000438.DJLA

CP000438.DJLA        Location/Qualifiers
FT   CDS             671164..671922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="PA14_07800"
FT                   /product="putative DnaJ-like protein DjlA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07800"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15562"
FT                   /db_xref="GOA:A0A0H2ZKJ9"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKJ9"
FT                   /protein_id="ABJ15562.1"
FT                   /translation="MLWPATLIGAGAGWALASIPGALLGGLLGQLLDRRLRLESWRGLL
FT                   ARLRGRAVNDEDDLLFQLLGYLAKSGGRVEEMHIRQAREEMALRKLDRRAQRRAIASFG
FT                   KGKAGIAHLQAEVARLKGERAEAVLLACWRMAWAGGVLSQSARQLVLQWGRWLGWSAER
FT                   TERLSARVMPKRTRAVARDSYREALLLLGVEAGSEPALIKRAYRKLISQHHPDKLAGAG
FT                   ASVERVRAATEKTRELQAAYALVREREGFR"
     MLWPATLIGA GAGWALASIP GALLGGLLGQ LLDRRLRLES WRGLLARLRG RAVNDEDDLL        60
     FQLLGYLAKS GGRVEEMHIR QAREEMALRK LDRRAQRRAI ASFGKGKAGI AHLQAEVARL       120
     KGERAEAVLL ACWRMAWAGG VLSQSARQLV LQWGRWLGWS AERTERLSAR VMPKRTRAVA       180
     RDSYREALLL LGVEAGSEPA LIKRAYRKLI SQHHPDKLAG AGASVERVRA ATEKTRELQA       240
     AYALVREREG FR                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page