(data stored in ACNUC7421 zone)

EMBL: CP000438.DSBB

CP000438.DSBB        Location/Qualifiers
FT   CDS             complement(606944..607453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="PA14_07000"
FT                   /product="disulfide bond formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07000"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15501"
FT                   /db_xref="GOA:Q02TM7"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TM7"
FT                   /protein_id="ABJ15501.1"
FT                   /translation="MSALLKPLDNRLFWPAVAIGGLLILAFVLYLQHVRGFAPCSLCIF
FT                   IRLDVLGLVLAGIVGSLAPRSRIAGGIAALGMLAASLGGIYHAWSLVAEEKLAAQGMGS
FT                   CKMFMGFPEWIPLDTWLPQVFQPEGLCGEVVWTLLGQSMAVWSLALFVFCLLVLAAKLA
FT                   FGRRTA"
     MSALLKPLDN RLFWPAVAIG GLLILAFVLY LQHVRGFAPC SLCIFIRLDV LGLVLAGIVG        60
     SLAPRSRIAG GIAALGMLAA SLGGIYHAWS LVAEEKLAAQ GMGSCKMFMG FPEWIPLDTW       120
     LPQVFQPEGL CGEVVWTLLG QSMAVWSLAL FVFCLLVLAA KLAFGRRTA                   169
//

If you have problems or comments...

PBIL Back to PBIL home page