(data stored in ACNUC7421 zone)

EMBL: CP000438.EXBB1

CP000438.EXBB1       Location/Qualifiers
FT   CDS             224960..225679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbB1"
FT                   /gene_synonym="exbB"
FT                   /locus_tag="PA14_02500"
FT                   /product="transport protein ExbB"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02500"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15153"
FT                   /db_xref="GOA:A0A0H2ZKC1"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC1"
FT                   /protein_id="ABJ15153.1"
FT                   /translation="MSLLTTPLESVEGAVIWLLVGFSVVTWGLALVKGVQFARQKRQDR
FT                   QFQKQFWSATSLDSAGEQAQDKQGAGARVAQAGFAAIQVQDNGQPDLAQSINHQDRLER
FT                   ALRQQIQRERRSLESGLAVLASIGSTSPFIGLFGTVWGIMEALKGISAAGSASLETVAG
FT                   PIGSALIATGVGIAVAVPAVLVYNYFLRRLKLTAADLDDFAHDFYSLAQKSAFRVIVHP
FT                   SAARQAGNPSRNVKEAS"
     MSLLTTPLES VEGAVIWLLV GFSVVTWGLA LVKGVQFARQ KRQDRQFQKQ FWSATSLDSA        60
     GEQAQDKQGA GARVAQAGFA AIQVQDNGQP DLAQSINHQD RLERALRQQI QRERRSLESG       120
     LAVLASIGST SPFIGLFGTV WGIMEALKGI SAAGSASLET VAGPIGSALI ATGVGIAVAV       180
     PAVLVYNYFL RRLKLTAADL DDFAHDFYSL AQKSAFRVIV HPSAARQAGN PSRNVKEAS        239
//

If you have problems or comments...

PBIL Back to PBIL home page