(data stored in ACNUC7421 zone)

EMBL: CP000438.EXBD1

CP000438.EXBD1       Location/Qualifiers
FT   CDS             225681..226082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD1"
FT                   /gene_synonym="exbD"
FT                   /locus_tag="PA14_02510"
FT                   /product="transport protein ExbD"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15154"
FT                   /db_xref="GOA:A0A0H2ZKL3"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL3"
FT                   /protein_id="ABJ15154.1"
FT                   /translation="MAFSTQDSDEVLSEINVTPLVDVMLVLLVVFIVTAPLLTNSIPIN
FT                   LPKTESVAPPEQKDPLVVSIDGAGKLFVNKDEIQPELLESNLAAAKAKDAEVRVQLQAD
FT                   EGVNYGQVAKAMASIERAGITRLAVITAR"
     MAFSTQDSDE VLSEINVTPL VDVMLVLLVV FIVTAPLLTN SIPINLPKTE SVAPPEQKDP        60
     LVVSIDGAGK LFVNKDEIQP ELLESNLAAA KAKDAEVRVQ LQADEGVNYG QVAKAMASIE       120
     RAGITRLAVI TAR                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page