(data stored in ACNUC7421 zone)

EMBL: CP000438.FIUA

CP000438.FIUA        Location/Qualifiers
FT   CDS             complement(542843..545236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fiuA"
FT                   /locus_tag="PA14_06160"
FT                   /product="putative hydroxamate-type ferrisiderophore
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15435"
FT                   /db_xref="GOA:A0A0H2ZKM8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKM8"
FT                   /protein_id="ABJ15435.1"
FT                   /translation="MPRPTFRPGLLALAIALAVPAPFLHAAPAEQASVRDYRIAAGPLA
FT                   GTLNRIAAQAGLVLTLDPALAEGRSAHAVQGRFDAPGALREALKGSGLELVENAGGTYS
FT                   LRKVPEDTLSLQAMTVSGAEEDPLGPTSGYVAKRSMTGTKTDTPILETPRSISVATRQQ
FT                   MTDRAVHNLDDAVRYMPGVVASSFGSDTRSDWLKVRGFKPTQFLDGLPMAVGVYNNPKL
FT                   ETWNLERVALLRGPASSVYGQTPPGGMLDMVSLRPQNVTSHEVKAEVGNYNHKQVSFDS
FT                   TGPLDDEGRFLYRISGVVRDSNTQVDHIDDKRYNIAPSLTWNIDDDTRLTFLGQFNRDD
FT                   TGITSQFLPLRGTKYDAPFGKVSHHKNLGDPDWEYYDRTYYWLGYAFERRINDVWQFRQ
FT                   NLRYLRNDLSFQAVTAGTAHADGTLERSTTSVDEDVSQFVVDNNFQADFETGALRHTLL
FT                   LGLDHNRTDNQYTSIFGSAPPSNVNNPIYGQPIVKPDRSTAFYDYKQKTYQTGLYVQDQ
FT                   IALDNWRLTLGGREDWVHTGATFYNKGDATNTSRDKKFSGNAALSYIFDNGVAPYISYA
FT                   ESFQPTTGADMNSTSSLKPTEGKQWEIGVKYQPVGSDSLFTAAVYDLRQENVSVSQNIG
FT                   GTPVTSQTGEVKVSGIELEATSNVTDNLKLIGAYSYADTEVKKGQYAGNRLQQAPRNQA
FT                   SLWADYTWHEGALNGFSVGAGARYVGSTYGDQANTYDGYAGSYTLYDAAVRYDLGQLNG
FT                   SLKGVSVAVNANNLFNKDYLASCDGYYCYYGDQRSVVGSVSYKW"
     MPRPTFRPGL LALAIALAVP APFLHAAPAE QASVRDYRIA AGPLAGTLNR IAAQAGLVLT        60
     LDPALAEGRS AHAVQGRFDA PGALREALKG SGLELVENAG GTYSLRKVPE DTLSLQAMTV       120
     SGAEEDPLGP TSGYVAKRSM TGTKTDTPIL ETPRSISVAT RQQMTDRAVH NLDDAVRYMP       180
     GVVASSFGSD TRSDWLKVRG FKPTQFLDGL PMAVGVYNNP KLETWNLERV ALLRGPASSV       240
     YGQTPPGGML DMVSLRPQNV TSHEVKAEVG NYNHKQVSFD STGPLDDEGR FLYRISGVVR       300
     DSNTQVDHID DKRYNIAPSL TWNIDDDTRL TFLGQFNRDD TGITSQFLPL RGTKYDAPFG       360
     KVSHHKNLGD PDWEYYDRTY YWLGYAFERR INDVWQFRQN LRYLRNDLSF QAVTAGTAHA       420
     DGTLERSTTS VDEDVSQFVV DNNFQADFET GALRHTLLLG LDHNRTDNQY TSIFGSAPPS       480
     NVNNPIYGQP IVKPDRSTAF YDYKQKTYQT GLYVQDQIAL DNWRLTLGGR EDWVHTGATF       540
     YNKGDATNTS RDKKFSGNAA LSYIFDNGVA PYISYAESFQ PTTGADMNST SSLKPTEGKQ       600
     WEIGVKYQPV GSDSLFTAAV YDLRQENVSV SQNIGGTPVT SQTGEVKVSG IELEATSNVT       660
     DNLKLIGAYS YADTEVKKGQ YAGNRLQQAP RNQASLWADY TWHEGALNGF SVGAGARYVG       720
     STYGDQANTY DGYAGSYTLY DAAVRYDLGQ LNGSLKGVSV AVNANNLFNK DYLASCDGYY       780
     CYYGDQRSVV GSVSYKW                                                      797
//

If you have problems or comments...

PBIL Back to PBIL home page