(data stored in ACNUC7421 zone)

EMBL: CP000438.FLIY

CP000438.FLIY        Location/Qualifiers
FT   CDS             complement(367838..368608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliY"
FT                   /locus_tag="PA14_04090"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04090"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15277"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKP3"
FT                   /protein_id="ABJ15277.1"
FT                   /translation="MRFLPRLLMLVSLAAPLAHAELLDDVHQRGALRIALEGTYPPFNF
FT                   KQGGKLTGFETELGELLAAELEVKPEFVTTEWSGILAGLQSGKYDIALNQVSVNEQRRK
FT                   VFDFSEPYTISSAQLIVRADDTRQFRSLEDLKGLKLGVGQGTNYADLAKSVAGVNVRTY
FT                   PGAPEYLQDLASKRIDAALNDRLLIPFAIREAKLPVKPGAAVGPVANMAIPYRKNNPKF
FT                   GEALNAALEKIKADGRFAKLSEKWFGLDVSQPPK"
     MRFLPRLLML VSLAAPLAHA ELLDDVHQRG ALRIALEGTY PPFNFKQGGK LTGFETELGE        60
     LLAAELEVKP EFVTTEWSGI LAGLQSGKYD IALNQVSVNE QRRKVFDFSE PYTISSAQLI       120
     VRADDTRQFR SLEDLKGLKL GVGQGTNYAD LAKSVAGVNV RTYPGAPEYL QDLASKRIDA       180
     ALNDRLLIPF AIREAKLPVK PGAAVGPVAN MAIPYRKNNP KFGEALNAAL EKIKADGRFA       240
     KLSEKWFGLD VSQPPK                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page