(data stored in ACNUC7421 zone)

EMBL: CP000438.FTSE

CP000438.FTSE        Location/Qualifiers
FT   CDS             433627..434298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="PA14_04910"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04910"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15340"
FT                   /db_xref="GOA:A0A0H2ZL67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL67"
FT                   /protein_id="ABJ15340.1"
FT                   /translation="MIRFEQVGKRYPNGHVGLHEVSFRVHRGEILFVTGHSGAGKSTLL
FT                   RLILAMERPTSGKLLLGGQDLGRITTAQIPFLRRQIGVVFQNHQLLTDRTVADNIALPL
FT                   QILGMPKPEIAKRVASALERVNLKEKGEALPSDLSTGQQQRVGIARAIVHQPALLLADE
FT                   PTGNLDPRLASEIMGVFEDINRLGTTVLIASHDLALIARMRHRMLTLQRGRIIADREDE
FT                   A"
     MIRFEQVGKR YPNGHVGLHE VSFRVHRGEI LFVTGHSGAG KSTLLRLILA MERPTSGKLL        60
     LGGQDLGRIT TAQIPFLRRQ IGVVFQNHQL LTDRTVADNI ALPLQILGMP KPEIAKRVAS       120
     ALERVNLKEK GEALPSDLST GQQQRVGIAR AIVHQPALLL ADEPTGNLDP RLASEIMGVF       180
     EDINRLGTTV LIASHDLALI ARMRHRMLTL QRGRIIADRE DEA                         223
//

If you have problems or comments...

PBIL Back to PBIL home page