(data stored in ACNUC7421 zone)

EMBL: CP000438.FTSX

CP000438.FTSX        Location/Qualifiers
FT   CDS             434298..435305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="PA14_04920"
FT                   /product="cell division ABC transporter, permease protein
FT                   FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04920"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15341"
FT                   /db_xref="GOA:A0A0H2ZKG8"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG8"
FT                   /protein_id="ABJ15341.1"
FT                   /translation="MSANDLPRGPEEGAPERKTREKPSQEQTDWSGSFSAYLESHRASL
FT                   VDSLRRLFGHPFGSFFTCLVMGITLSLPMGLSLLLNNVERLGGSWQRAAQISLFLDLKT
FT                   SENQGQDLREQIERLPDVIEAQLISREQALSELQEQSGLGEALKELPENPLPPVISVTP
FT                   KQIDRAGLEALRQQLAELPHVQQAQLDLVWVERLSAILKLGERFVFGLTILLVLTLLLV
FT                   VGNTIRLHIENRRNEIEVIKLVGGTDGYVRRPFLYMGALYGLGAGILSWALLAYSLNWL
FT                   NGSVVNLSGLYGSDFGLQGVPLDDGLSLTVGAVLLGWVGAWLAVARHLRELAPR"
     MSANDLPRGP EEGAPERKTR EKPSQEQTDW SGSFSAYLES HRASLVDSLR RLFGHPFGSF        60
     FTCLVMGITL SLPMGLSLLL NNVERLGGSW QRAAQISLFL DLKTSENQGQ DLREQIERLP       120
     DVIEAQLISR EQALSELQEQ SGLGEALKEL PENPLPPVIS VTPKQIDRAG LEALRQQLAE       180
     LPHVQQAQLD LVWVERLSAI LKLGERFVFG LTILLVLTLL LVVGNTIRLH IENRRNEIEV       240
     IKLVGGTDGY VRRPFLYMGA LYGLGAGILS WALLAYSLNW LNGSVVNLSG LYGSDFGLQG       300
     VPLDDGLSLT VGAVLLGWVG AWLAVARHLR ELAPR                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page