(data stored in ACNUC7421 zone)

EMBL: CP000438.FTSY

CP000438.FTSY        Location/Qualifiers
FT   CDS             432275..433630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="PA14_04900"
FT                   /product="signal recognition particle receptor FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_04900"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15339"
FT                   /db_xref="GOA:A0A0H2ZKT5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKT5"
FT                   /protein_id="ABJ15339.1"
FT                   /translation="MFGSNDDKKAPQGGEKKGLFGWWRKKPQAGEQPADQPVEPVSETA
FT                   AAEQRAPADDVAQSLTEQPGRQQPSAAEPAEPPAPVAEAPLAGDEPASAEEHSPRPEAP
FT                   VAQPEPILAAEPEPEPEPEPEPVAPLAAAPAVSEPATRPGFFARLRQGLSKTSASIGEG
FT                   MASLFLGRKEIDDDLLDDIETRLLTADVGVEATTLIVQNLTKRVARKELADSGALYKAL
FT                   QEELASLLRPVEQPLQVDVAREPYVILVVGVNGVGKTTTIGKLAKKLQLEGKKVMLAAG
FT                   DTFRAAAVEQLQVWGERNRIPVIAQHTGADSASVIFDAVQAAKARGIDVLIADTAGRLH
FT                   TKDNLMEELKKVRRVIGKLDETAPHEVLLVLDAGTGQNAINQAKQFNLAVELTGLALTK
FT                   LDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEADAFVQALFAERENA"
     MFGSNDDKKA PQGGEKKGLF GWWRKKPQAG EQPADQPVEP VSETAAAEQR APADDVAQSL        60
     TEQPGRQQPS AAEPAEPPAP VAEAPLAGDE PASAEEHSPR PEAPVAQPEP ILAAEPEPEP       120
     EPEPEPVAPL AAAPAVSEPA TRPGFFARLR QGLSKTSASI GEGMASLFLG RKEIDDDLLD       180
     DIETRLLTAD VGVEATTLIV QNLTKRVARK ELADSGALYK ALQEELASLL RPVEQPLQVD       240
     VAREPYVILV VGVNGVGKTT TIGKLAKKLQ LEGKKVMLAA GDTFRAAAVE QLQVWGERNR       300
     IPVIAQHTGA DSASVIFDAV QAAKARGIDV LIADTAGRLH TKDNLMEELK KVRRVIGKLD       360
     ETAPHEVLLV LDAGTGQNAI NQAKQFNLAV ELTGLALTKL DGTAKGGVIF ALAKQFGLPI       420
     RYIGVGEGID DLRTFEADAF VQALFAEREN A                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page