(data stored in ACNUC7421 zone)

EMBL: CP000438.GLTX

CP000438.GLTX        Location/Qualifiers
FT   CDS             complement(508105..509472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="PA14_05750"
FT                   /product="putative glutamate synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05750"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15407"
FT                   /db_xref="GOA:A0A0H2ZL57"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL57"
FT                   /protein_id="ABJ15407.1"
FT                   /translation="MIDSLNHLPRPDAGADTLAERFADLAPPLNARQAALESARCLYCY
FT                   DAPCVNACPTEIDIPGFIRSIAQENVQGAAQKILSANILGGSCARVCPTEILCQRACVR
FT                   NNAQECAPVLIGQLQRYALDHAGFGEHPFKRSPATGKRIAVVGAGPAGLSCAHRLAMHG
FT                   HDVVLFEARAKVGGLNEYGIARYKLVDDFARREVEFLLQIGGIELRHGQRLGDNLALGA
FT                   LHDEYDAVFLGIGLAASKRLGLEDEDAPGLLAATDYIRELRQSDDLLDLPVADRCIVIG
FT                   AGNTAIDMAVQMSRLGARDVNLVYRRGFEEMGATGHEQEIAKASQVRLLTWARPERVLL
FT                   DEQGRVRGMRFARTRLENGRLGDTGEHFELAADAIFKAIGQAFEGASLGDPLAAQLRRD
FT                   GERIQVDGQMRTSIPGIYAGGDCVALGEDLTVQAVQHGKLAAEAIHAQLMLNVEAA"
     MIDSLNHLPR PDAGADTLAE RFADLAPPLN ARQAALESAR CLYCYDAPCV NACPTEIDIP        60
     GFIRSIAQEN VQGAAQKILS ANILGGSCAR VCPTEILCQR ACVRNNAQEC APVLIGQLQR       120
     YALDHAGFGE HPFKRSPATG KRIAVVGAGP AGLSCAHRLA MHGHDVVLFE ARAKVGGLNE       180
     YGIARYKLVD DFARREVEFL LQIGGIELRH GQRLGDNLAL GALHDEYDAV FLGIGLAASK       240
     RLGLEDEDAP GLLAATDYIR ELRQSDDLLD LPVADRCIVI GAGNTAIDMA VQMSRLGARD       300
     VNLVYRRGFE EMGATGHEQE IAKASQVRLL TWARPERVLL DEQGRVRGMR FARTRLENGR       360
     LGDTGEHFEL AADAIFKAIG QAFEGASLGD PLAAQLRRDG ERIQVDGQMR TSIPGIYAGG       420
     DCVALGEDLT VQAVQHGKLA AEAIHAQLML NVEAA                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page