(data stored in ACNUC7421 zone)

EMBL: CP000438.GPI

CP000438.GPI         Location/Qualifiers
FT   CDS             690976..691509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpI"
FT                   /locus_tag="PA14_08040"
FT                   /product="putative phage tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15583"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLN8"
FT                   /protein_id="ABJ15583.1"
FT                   /translation="MSSRLLPPNRSSLERSLGDVLPAELPVPLRELNDPARCEAALLPY
FT                   LAWTRSVDRWDPDWSDEAKRNAVATSFVLHQRKGTLTALRQVVEPIGALSEVTEWWQRS
FT                   PTGVPGTFEITVDVSDRGIDEGTVLELERLLDDVRPVSRHLTRLDLRITPVIRSRHGLA
FT                   VTDGDTLEIFPWKQ"
     MSSRLLPPNR SSLERSLGDV LPAELPVPLR ELNDPARCEA ALLPYLAWTR SVDRWDPDWS        60
     DEAKRNAVAT SFVLHQRKGT LTALRQVVEP IGALSEVTEW WQRSPTGVPG TFEITVDVSD       120
     RGIDEGTVLE LERLLDDVRP VSRHLTRLDL RITPVIRSRH GLAVTDGDTL EIFPWKQ          177
//

If you have problems or comments...

PBIL Back to PBIL home page