(data stored in ACNUC7421 zone)

EMBL: CP000438.GPV

CP000438.GPV         Location/Qualifiers
FT   CDS             689063..689620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpV"
FT                   /locus_tag="PA14_08010"
FT                   /product="putative baseplate assembly protein V"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15580"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLV0"
FT                   /protein_id="ABJ15580.1"
FT                   /translation="MSYVSAEHDRMLAAMILPCVVVAVDLAAARVRVRSGDWTSGWLRW
FT                   HSLAAGKVRHWRAPSIGEQGVLLSPSGGVSMGTFIPGLYGDAGTAPDNSASSETWRFDD
FT                   GASLSYDWAAHRYRVELPSGTVEVRVGASEVRVSDGAVSLKAPKISLEGPVEIAGTLTV
FT                   SGDILGGGSIIDTAGNSNHHTH"
     MSYVSAEHDR MLAAMILPCV VVAVDLAAAR VRVRSGDWTS GWLRWHSLAA GKVRHWRAPS        60
     IGEQGVLLSP SGGVSMGTFI PGLYGDAGTA PDNSASSETW RFDDGASLSY DWAAHRYRVE       120
     LPSGTVEVRV GASEVRVSDG AVSLKAPKIS LEGPVEIAGT LTVSGDILGG GSIIDTAGNS       180
     NHHTH                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page