(data stored in ACNUC7421 zone)

EMBL: CP000438.GPW

CP000438.GPW         Location/Qualifiers
FT   CDS             689773..690099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpW"
FT                   /locus_tag="PA14_08020"
FT                   /product="putative baseplate assembly protein W"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15581"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKZ9"
FT                   /protein_id="ABJ15581.1"
FT                   /translation="MIGMDRRSGLPLSGLAHLKQSVEDILTTPLGSRRMRPEYGSKLRR
FT                   MVDMPVSEGWKSAVQAEVARSLGRWEPRIALSAVRVVAVVDGRVDLLLSGVFEGENINM
FT                   EVSA"
     MIGMDRRSGL PLSGLAHLKQ SVEDILTTPL GSRRMRPEYG SKLRRMVDMP VSEGWKSAVQ        60
     AEVARSLGRW EPRIALSAVR VVAVVDGRVD LLLSGVFEGE NINMEVSA                    108
//

If you have problems or comments...

PBIL Back to PBIL home page