(data stored in ACNUC7421 zone)

EMBL: CP000438.GYRB

CP000438.GYRB        Location/Qualifiers
FT   CDS             4275..6695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="PA14_00050"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14960"
FT                   /db_xref="GOA:A0A0H2ZJS1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS1"
FT                   /protein_id="ABJ14960.1"
FT                   /translation="MSENNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEV
FT                   VDNSIDEALAGYCSEISITIHTDESITVRDNGRGIPVDIHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNTYKVSGGLHGVGVSVVNALSHELRLTIRRHNKVWEQVYHHGVPQFPLREVGETD
FT                   GSGTEVHFKPSPETFSNIHFSWDILAKRIRELSFLNSGVGILLRDERTGKEELFKYEGG
FT                   LKAFVEYLNTNKTAVNEVFHFNVQREEDGVGVEVALQWNDSFNENLLCFTNNIPQRDGG
FT                   THLAGFRSALTRNLNNYIEAEGLAKKFKIATTGDDAREGLTAIISVKVPDPKFSSQTKD
FT                   KLVSSEVKTAVEQEMGKYFADFLLENPNEAKAVVGKMIDAARAREAARKAREMTRRKGA
FT                   LDIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRRTQAILPLKGKILNVEKA
FT                   RFDKMLSSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFF
FT                   RQMPELIERGYIYIAQPPLYKVKRGKQEQYIKDDQAMEEYMTQSALEDASLHVNEHAPG
FT                   LSGAALEKLVNEYRGVIATLKRLSRLYPQELTEHFIYLPTVSVDDLANESAMQGWLEKF
FT                   QARLTAAEKSGLTYKASLREDRERHLWLPEVELVAHGLSSYVTFNRDFFASNDYRSVSL
FT                   LGDQLNSLLEDGAYVQKGERKRPISAFKDGLDWLMAEGTKRHSIQRYKGLGEMNPEQLW
FT                   ETTMDPNVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNALAVSNLDV"
     MSENNTYDSS SIKVLKGLDA VRKRPGMYIG DTDDGTGLHH MVFEVVDNSI DEALAGYCSE        60
     ISITIHTDES ITVRDNGRGI PVDIHKEEGV SAAEVIMTVL HAGGKFDDNT YKVSGGLHGV       120
     GVSVVNALSH ELRLTIRRHN KVWEQVYHHG VPQFPLREVG ETDGSGTEVH FKPSPETFSN       180
     IHFSWDILAK RIRELSFLNS GVGILLRDER TGKEELFKYE GGLKAFVEYL NTNKTAVNEV       240
     FHFNVQREED GVGVEVALQW NDSFNENLLC FTNNIPQRDG GTHLAGFRSA LTRNLNNYIE       300
     AEGLAKKFKI ATTGDDAREG LTAIISVKVP DPKFSSQTKD KLVSSEVKTA VEQEMGKYFA       360
     DFLLENPNEA KAVVGKMIDA ARAREAARKA REMTRRKGAL DIAGLPGKLA DCQEKDPALS       420
     ELYIVEGDSA GGSAKQGRNR RTQAILPLKG KILNVEKARF DKMLSSQEVG TLITALGCGI       480
     GREEYNIDKL RYHNIIIMTD ADVDGSHIRT LLLTFFFRQM PELIERGYIY IAQPPLYKVK       540
     RGKQEQYIKD DQAMEEYMTQ SALEDASLHV NEHAPGLSGA ALEKLVNEYR GVIATLKRLS       600
     RLYPQELTEH FIYLPTVSVD DLANESAMQG WLEKFQARLT AAEKSGLTYK ASLREDRERH       660
     LWLPEVELVA HGLSSYVTFN RDFFASNDYR SVSLLGDQLN SLLEDGAYVQ KGERKRPISA       720
     FKDGLDWLMA EGTKRHSIQR YKGLGEMNPE QLWETTMDPN VRRMLKVTIE DAIAADQIFN       780
     TLMGDAVEPR RDFIESNALA VSNLDV                                            806
//

If you have problems or comments...

PBIL Back to PBIL home page