(data stored in ACNUC7421 zone)

EMBL: CP000438.HCPC

CP000438.HCPC        Location/Qualifiers
FT   CDS             complement(288454..288972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcpC"
FT                   /locus_tag="PA14_03240"
FT                   /product="Secreted protein Hcp"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_03240"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15212"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Z8M3"
FT                   /protein_id="ABJ15212.1"
FT                   /translation="MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFN
FT                   HEVIIPRDPQSGQPTGQRVHKPVVITKVFDKASPLLLAALTSGERLTKVEIQWYRTSAA
FT                   GTQEHYYTTVLEDAIIVDIKDYMHNCQDPGNAHFTHLEDVHFTYRKITWTHEVSGTSGS
FT                   DDWRSPVAG"
     MATPAYMSIT GTKQGLITAG AFTEDSVGNT YQEGHEDQVM VQGFNHEVII PRDPQSGQPT        60
     GQRVHKPVVI TKVFDKASPL LLAALTSGER LTKVEIQWYR TSAAGTQEHY YTTVLEDAII       120
     VDIKDYMHNC QDPGNAHFTH LEDVHFTYRK ITWTHEVSGT SGSDDWRSPV AG               172
//

If you have problems or comments...

PBIL Back to PBIL home page