(data stored in ACNUC7421 zone)

EMBL: CP000438.MCDM

CP000438.MCDM        Location/Qualifiers
FT   CDS             233992..234756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcdM"
FT                   /locus_tag="PA14_02640"
FT                   /product="putative malonate transporter, MadM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02640"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15165"
FT                   /db_xref="GOA:A0A0H2ZKD1"
FT                   /db_xref="InterPro:IPR004691"
FT                   /db_xref="InterPro:IPR018402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD1"
FT                   /protein_id="ABJ15165.1"
FT                   /translation="MFESLNKVINGYGLISGFAIIGVTMAVSYWLSARLTRGRLHGSAI
FT                   AIFLGLVLSYVGGVATGGQKGLVDVPLMSGIGLLGGAMLRDFAIVATAFGVNVEELRRA
FT                   GVSGVVSLFLGVGSSFVAGVAVAMAFGYTDAVSLTTIGAGAVTYIVGPVTGAALGASSE
FT                   VMALSIAAGLVKAILVMVLTPFVAPYIGLNNPRTAVIFGGLMGTSSGVAGGLAATDPKL
FT                   VPYGCLTAAFYTAIGCLLGPSLLYFSVRGLVG"
     MFESLNKVIN GYGLISGFAI IGVTMAVSYW LSARLTRGRL HGSAIAIFLG LVLSYVGGVA        60
     TGGQKGLVDV PLMSGIGLLG GAMLRDFAIV ATAFGVNVEE LRRAGVSGVV SLFLGVGSSF       120
     VAGVAVAMAF GYTDAVSLTT IGAGAVTYIV GPVTGAALGA SSEVMALSIA AGLVKAILVM       180
     VLTPFVAPYI GLNNPRTAVI FGGLMGTSSG VAGGLAATDP KLVPYGCLTA AFYTAIGCLL       240
     GPSLLYFSVR GLVG                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page