(data stored in ACNUC7421 zone)

EMBL: CP000438.MDCA

CP000438.MDCA        Location/Qualifiers
FT   CDS             227383..229047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcA"
FT                   /locus_tag="PA14_02550"
FT                   /product="malonate decarboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15157"
FT                   /db_xref="GOA:A0A0H2ZKD9"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD9"
FT                   /protein_id="ABJ15157.1"
FT                   /translation="MTTPISPPPQWSRRRQEKQRRLERVRGLADGAVLPRERLVAALEA
FT                   LIAPGDRVVLEGNNQKQADFLSRSLARVDPGKLHDLHMIMPSVGRPEHLDLFELGIARK
FT                   LDFSFSGPQSLRIGQLLEDGLLEIGAIHTYIELYARLVVDLIPNVALVAGFVADREGNV
FT                   YTGPSTEDTPALVEPTAFSDGIVIVQVNRIVDDPRDLPRVDIPASWVDFVVEADQPFYI
FT                   EPLFTRDPRHIKPVHVLMAMMAIRGIYQRHNVQSLNHGIGFNTAAIELILPTYGESLGL
FT                   KGKICRHWTLNPHPTLIPAIESGWVESVHCFGTELGMEGYIAQRPDVFFTGRDGSLRSN
FT                   RMFCQLAGQYAVDLFIGATLQVDGDGHSSTVTRGRLAGFGGAPNMGHDPRGRRHSTAAW
FT                   LDMRGEPEALLERGRKLVVQMVETFQDGGKPTFVERLDALEVARQTGMPLAPVMIYGDD
FT                   VTHVLTEEGIAYLYKARSLEERQAMIAAVAGISPIGLRHDPRETQRMRREGLIALPEDL
FT                   GIRRTDASRELLAAKSIAELVEWSGGLYQPPARFRSW"
     MTTPISPPPQ WSRRRQEKQR RLERVRGLAD GAVLPRERLV AALEALIAPG DRVVLEGNNQ        60
     KQADFLSRSL ARVDPGKLHD LHMIMPSVGR PEHLDLFELG IARKLDFSFS GPQSLRIGQL       120
     LEDGLLEIGA IHTYIELYAR LVVDLIPNVA LVAGFVADRE GNVYTGPSTE DTPALVEPTA       180
     FSDGIVIVQV NRIVDDPRDL PRVDIPASWV DFVVEADQPF YIEPLFTRDP RHIKPVHVLM       240
     AMMAIRGIYQ RHNVQSLNHG IGFNTAAIEL ILPTYGESLG LKGKICRHWT LNPHPTLIPA       300
     IESGWVESVH CFGTELGMEG YIAQRPDVFF TGRDGSLRSN RMFCQLAGQY AVDLFIGATL       360
     QVDGDGHSST VTRGRLAGFG GAPNMGHDPR GRRHSTAAWL DMRGEPEALL ERGRKLVVQM       420
     VETFQDGGKP TFVERLDALE VARQTGMPLA PVMIYGDDVT HVLTEEGIAY LYKARSLEER       480
     QAMIAAVAGI SPIGLRHDPR ETQRMRREGL IALPEDLGIR RTDASRELLA AKSIAELVEW       540
     SGGLYQPPAR FRSW                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page