(data stored in ACNUC7421 zone)

EMBL: CP000438.MDCC

CP000438.MDCC        Location/Qualifiers
FT   CDS             229930..230229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcC"
FT                   /locus_tag="PA14_02570"
FT                   /product="malonate decarboxylase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02570"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15159"
FT                   /db_xref="GOA:Q02UM5"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UM5"
FT                   /protein_id="ABJ15159.1"
FT                   /translation="METLTFEFPAGAPARGRALAGCVGSGDLEVLLEPAAGGALSIQVV
FT                   TSVNGSGPRWQQLFARVFAASTAPAASIRIHDFGATPGVVRLRLEQALEEAGHD"
     METLTFEFPA GAPARGRALA GCVGSGDLEV LLEPAAGGAL SIQVVTSVNG SGPRWQQLFA        60
     RVFAASTAPA ASIRIHDFGA TPGVVRLRLE QALEEAGHD                               99
//

If you have problems or comments...

PBIL Back to PBIL home page