(data stored in ACNUC7421 zone)

EMBL: CP000438.MDCD

CP000438.MDCD        Location/Qualifiers
FT   CDS             230222..231085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcD"
FT                   /locus_tag="PA14_02580"
FT                   /product="malonate decarboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15160"
FT                   /db_xref="GOA:A0A0H2ZKC6"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC6"
FT                   /protein_id="ABJ15160.1"
FT                   /translation="MTDVARLLALRSFTELGARQRARALLDAGSFRELLDPFAGVQSPW
FT                   LERQGIVPQADDGVVVARGLLDGQPAVLAAIEGAFQGGSLGEVSGAKIAGALELAAEDN
FT                   RNGVPTRALLLLETGGVRLQEANLGLAAIAEIQAAIVDLQRYQPVVAVIAGPVGCFGGM
FT                   SIAAGLCSYVLVTREARLGLNGPQVIEQEAGIAEYDSRDRPFIWSLTGGEQRFASGLAD
FT                   AYLADDLDEVRTSVLAYFAKGLPARPRCRRAEDYLRRLGDLDTAEQPDAAGVRRLYQGL
FT                   GQGDAT"
     MTDVARLLAL RSFTELGARQ RARALLDAGS FRELLDPFAG VQSPWLERQG IVPQADDGVV        60
     VARGLLDGQP AVLAAIEGAF QGGSLGEVSG AKIAGALELA AEDNRNGVPT RALLLLETGG       120
     VRLQEANLGL AAIAEIQAAI VDLQRYQPVV AVIAGPVGCF GGMSIAAGLC SYVLVTREAR       180
     LGLNGPQVIE QEAGIAEYDS RDRPFIWSLT GGEQRFASGL ADAYLADDLD EVRTSVLAYF       240
     AKGLPARPRC RRAEDYLRRL GDLDTAEQPD AAGVRRLYQG LGQGDAT                     287
//

If you have problems or comments...

PBIL Back to PBIL home page